PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID RrC7091_p1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family Dof
Protein Properties Length: 287aa    MW: 32384.1 Da    PI: 8.8383
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
RrC7091_p1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof123.85.6e-391675261
      zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61
                 +++lkcprC+s+ntkfCyynnyslsqPr+fCk+CrryWt+GG+lrnvP+Ggg+rk kks
  RrC7091_p1 16 DQQTLKCPRCNSSNTKFCYYNNYSLSQPRHFCKSCRRYWTRGGSLRNVPIGGGCRKTKKS 75
                57899****************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074787.0E-34374IPR003851Zinc finger, Dof-type
PfamPF027014.2E-331874IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.4782074IPR003851Zinc finger, Dof-type
PROSITE patternPS0136102258IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 287 aa     Download sequence    Send to blast
MSSHTKKPPS STASQDQQTL KCPRCNSSNT KFCYYNNYSL SQPRHFCKSC RRYWTRGGSL  60
RNVPIGGGCR KTKKSIKPNI MAPSSSSAQR FFFSTMEEAS KFFPPPTAMD FQLAELSLNK  120
INDLQLMNNQ EVLGLRTTME QVGTTPVDVG SGLTLTGFGV YNTNNSSHSP ATFTTDENLA  180
TSIETLSCLN QDLHWRLQQQ RMAMFFGNSK EETVVVERPQ PLLYRNLEIV NSSPSPTTKK  240
GENQTEWYFG NNNDNERVIN NKDNNKTGGS DQWNNGIQAW TDLNHYN
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1892661e-105AC189266.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB022L12, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009130518.10.0PREDICTED: dof zinc finger protein DOF5.7-like
SwissprotQ9LSL61e-152DOF57_ARATH; Dof zinc finger protein DOF5.7
TrEMBLM4ESS30.0M4ESS3_BRARP; Uncharacterized protein
STRINGBra031853.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM49502850
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G65590.11e-154Dof family protein